Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxj1 Peptide - middle region

Foxj1 Peptide - middle region

Product Specifications

Product Name Alternative

FKHL-13, HFH-4, Hfh4

UniProt

Q3US42

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxj1 Rabbit Polyclonal Antibody (orb576446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032266

Preservative

Lyophilized powder

AA Sequence

YAERLLSGAFKKRRLPPVHIHPAFARQASQEPSAAPWGGPLTVNREAQQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CYP39A1 Antibody (M30P6D6) [Alexa Fluor 405]
NBP2-50206AF405 0.1 mL

Mouse Monoclonal CYP39A1 Antibody (M30P6D6) [Alexa Fluor 405]

Sign In for Pricing
View Details
Mouse Grp Pre-designed siRNA Set A
SI105888A 1 Each

Mouse Grp Pre-designed siRNA Set A

Sign In for Pricing
View Details
Pim-1 Antibody
B0712-01 50 μL

Pim-1 Antibody

Sign In for Pricing
View Details
Pim-1 Antibody
B0712-02 100 µL

Pim-1 Antibody

Sign In for Pricing
View Details
Mesenchymal Stem Cells, Mouse, Growth Medium Supplement
M3005-34A2 35ml

Mesenchymal Stem Cells, Mouse, Growth Medium Supplement

Sign In for Pricing
View Details
Vildagliptin Impurity 104 discontinued see RM-V163209
RM-V163304-01 10 mg

Vildagliptin Impurity 104 discontinued see RM-V163209

Sign In for Pricing
View Details