Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxk1 Peptide - middle region

Foxk1 Peptide - middle region

Product Specifications

Product Name Alternative

A630048H08Rik, AI463295, Mnf, Gm10868, ENSMUSG00000075577

UniProt

P42128

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxk1 Rabbit Polyclonal Antibody (orb576468) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_951031

Preservative

Lyophilized powder

AA Sequence

STGTSHDTAGTAVLDLGNEARGLEEKPTIAFATIPAASRVIQTVASQMAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC2A13 Rabbit Polyclonal Antibody (BF647)
orb2465283 100 µL

SLC2A13 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
TMEFF1 3'UTR GFP Stable Cell Line
TU075709 1.0 mL

TMEFF1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
NXN Knockout Hela Polyclonal Cells
ARG7986 1 Million

NXN Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Human DAO Protein (His Tag)
PDEH101148-01 20 µg

Recombinant Human DAO Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human DAO Protein (His Tag)
PDEH101148-02 100 µg

Recombinant Human DAO Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human DAO Protein (His Tag)
PDEH101148-03 500 µg

Recombinant Human DAO Protein (His Tag)

Sign In for Pricing
View Details