Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxk1 Peptide - middle region

Foxk1 Peptide - middle region

Product Specifications

Product Name Alternative

A630048H08Rik, AI463295, Mnf, Gm10868, ENSMUSG00000075577

UniProt

P42128

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxk1 Rabbit Polyclonal Antibody (orb576468) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_951031

Preservative

Lyophilized powder

AA Sequence

STGTSHDTAGTAVLDLGNEARGLEEKPTIAFATIPAASRVIQTVASQMAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYT2, ID (SYT2, Synaptotagmin-2, Synaptotagmin II) (MaxLight 750)
MBS6353015-01 0.1 mL

SYT2, ID (SYT2, Synaptotagmin-2, Synaptotagmin II) (MaxLight 750)

Sign In for Pricing
View Details
SYT2, ID (SYT2, Synaptotagmin-2, Synaptotagmin II) (MaxLight 750)
MBS6353015-02 5x 0.1 mL

SYT2, ID (SYT2, Synaptotagmin-2, Synaptotagmin II) (MaxLight 750)

Sign In for Pricing
View Details
Anti-LAG3 (encelimab biosimilar) mAb
MBS1881177-01 0.05 mg

Anti-LAG3 (encelimab biosimilar) mAb

Sign In for Pricing
View Details
Anti-LAG3 (encelimab biosimilar) mAb
MBS1881177-02 0.1 mg

Anti-LAG3 (encelimab biosimilar) mAb

Sign In for Pricing
View Details
Anti-LAG3 (encelimab biosimilar) mAb
MBS1881177-03 5x 0.1 mg

Anti-LAG3 (encelimab biosimilar) mAb

Sign In for Pricing
View Details
Porcine CNTN1 (Contactin 1) ELISA Kit
MBS2505918-01 24 Tests

Porcine CNTN1 (Contactin 1) ELISA Kit

Sign In for Pricing
View Details