Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXK2 Peptide - C-terminal region

FOXK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ILF, ILF-1, ILF1

UniProt

Q01167

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXK2 Rabbit Polyclonal Antibody (orb575300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852096

Preservative

Lyophilized powder

AA Sequence

KQLTLNGIYTHITKNYPYYRTADKGWQRGESFAHVGNTRIRIGLPAHKAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIVIN, CT (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor Of Apoptosis Protein, KIAP, Melanoma Inhibitor Of Apoptosis Protein, ML-IAP, Livin, RING Finger Protein 50, KIAP, BIRC7, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344) (Azide free) (HRP)
MBS6485356-01 0.2 mL

LIVIN, CT (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor Of Apoptosis Protein, KIAP, Melanoma Inhibitor Of Apoptosis Protein, ML-IAP, Livin, RING Finger Protein 50, KIAP, BIRC7, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344) (Azide free) (HRP)

Sign In for Pricing
View Details
LIVIN, CT (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor Of Apoptosis Protein, KIAP, Melanoma Inhibitor Of Apoptosis Protein, ML-IAP, Livin, RING Finger Protein 50, KIAP, BIRC7, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344) (Azide free) (HRP)
MBS6485356-02 5x 0.2 mL

LIVIN, CT (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor Of Apoptosis Protein, KIAP, Melanoma Inhibitor Of Apoptosis Protein, ML-IAP, Livin, RING Finger Protein 50, KIAP, BIRC7, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344) (Azide free) (HRP)

Sign In for Pricing
View Details
FREAC for Neomycin-GFP Luciferase Vectors (LR-2XXXN)
LR-2038N 1 Each

FREAC for Neomycin-GFP Luciferase Vectors (LR-2XXXN)

Sign In for Pricing
View Details
USP33 Protein Vector (Rat) (pPB-N-His)
PV314795 500 ng

USP33 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
(2S) -N-Methyloxolane-2-carboxamide
XYB38656-01 50 mg

(2S) -N-Methyloxolane-2-carboxamide

Sign In for Pricing
View Details
(2S) -N-Methyloxolane-2-carboxamide
XYB38656-02 0.5 g

(2S) -N-Methyloxolane-2-carboxamide

Sign In for Pricing
View Details