Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXK2 Peptide - C-terminal region

FOXK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ILF, ILF-1, ILF1

UniProt

Q01167

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXK2 Rabbit Polyclonal Antibody (orb575300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852096

Preservative

Lyophilized powder

AA Sequence

KQLTLNGIYTHITKNYPYYRTADKGWQRGESFAHVGNTRIRIGLPAHKAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA
orb1710484-01 10 mg

Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA

Sign In for Pricing
View Details
Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA
orb1710484-02 50 mg

Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA

Sign In for Pricing
View Details
Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA
orb1710484-03 1 mg

Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA

Sign In for Pricing
View Details
Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA
orb1710484-04 5 mg

Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA

Sign In for Pricing
View Details
Bovine Phosphoglucomutase-1, PGM1 ELISA Kit
MBS9329279-01 48 Well

Bovine Phosphoglucomutase-1, PGM1 ELISA Kit

Sign In for Pricing
View Details
Bovine Phosphoglucomutase-1, PGM1 ELISA Kit
MBS9329279-02 96 Well

Bovine Phosphoglucomutase-1, PGM1 ELISA Kit

Sign In for Pricing
View Details