Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxn2 Peptide - N-terminal region

Foxn2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

3230402J05Rik, 6030465J18Rik, Fkh19, Foxn1, HTLF

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxn2 Rabbit Polyclonal Antibody (orb576349) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_851305

Preservative

Lyophilized powder

AA Sequence

MGPVIGMTPDKRAETPGAEKVAGLSQIYKMGSLPEAGDAARPKATLVGSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CKM Polyclonal Antibody
E-AB-15494-01 20 µL

CKM Polyclonal Antibody

Sign In for Pricing
View Details
CKM Polyclonal Antibody
E-AB-15494-02 60 µL

CKM Polyclonal Antibody

Sign In for Pricing
View Details
CKM Polyclonal Antibody
E-AB-15494-03 120 µL

CKM Polyclonal Antibody

Sign In for Pricing
View Details
CKM Polyclonal Antibody
E-AB-15494-04 200 µL

CKM Polyclonal Antibody

Sign In for Pricing
View Details
SLC23A2 (NM_203327) Human Over-expression Lysate
LC404396 20 µg

SLC23A2 (NM_203327) Human Over-expression Lysate

Sign In for Pricing
View Details
NUR77 Recombinant Rabbit Monoclonal Antibody [JM59-11]
ET1703-97 100 µL

NUR77 Recombinant Rabbit Monoclonal Antibody [JM59-11]

Sign In for Pricing
View Details