Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxn2 Peptide - N-terminal region

Foxn2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

3230402J05Rik, 6030465J18Rik, Fkh19, Foxn1, HTLF

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxn2 Rabbit Polyclonal Antibody (orb576349) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_851305

Preservative

Lyophilized powder

AA Sequence

MGPVIGMTPDKRAETPGAEKVAGLSQIYKMGSLPEAGDAARPKATLVGSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human COL1α1 (Collagen Type I Alpha 1) ELISA Kit
E-EL-H0869-01 24 Tests

Human COL1α1 (Collagen Type I Alpha 1) ELISA Kit

Sign In for Pricing
View Details
Human COL1α1 (Collagen Type I Alpha 1) ELISA Kit
E-EL-H0869-02 48 Tests

Human COL1α1 (Collagen Type I Alpha 1) ELISA Kit

Sign In for Pricing
View Details
Human COL1α1 (Collagen Type I Alpha 1) ELISA Kit
E-EL-H0869-03 96 Tests

Human COL1α1 (Collagen Type I Alpha 1) ELISA Kit

Sign In for Pricing
View Details
EGFR Inhibitor
TRC-E244110-500MG 500 mg

EGFR Inhibitor

Sign In for Pricing
View Details
Recombinant Rat CD23 Protein (Fc Tag)
PKSR030317-01 100 µg

Recombinant Rat CD23 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat CD23 Protein (Fc Tag)
PKSR030317-02 1 mg

Recombinant Rat CD23 Protein (Fc Tag)

Sign In for Pricing
View Details