Foxn2 Peptide - N-terminal region
Foxn2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
3230402J05Rik, 6030465J18Rik, Fkh19, Foxn1, HTLF
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Foxn2 Rabbit Polyclonal Antibody (orb576350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_851305
Preservative
Lyophilized powder
AA Sequence
KRAETPGAEKVAGLSQIYKMGSLPEAGDAARPKATLVGSESADDELTNLN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC422768 20 µg
CSPS (SuLT1A3) (NM_001017387) Human Over-expression Lysate
Sign In for Pricing
View Details ![DLX1 Mouse Monoclonal Antibody [Clone ID: OTI1E6]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908f21/imageurl/cf811631.webp)
PDMH100165-01 20 µg
Recombinant Human Cathepsin B Protein (His Tag)
Sign In for Pricing
View Details PDMH100165-02 100 µg
Recombinant Human Cathepsin B Protein (His Tag)
Sign In for Pricing
View Details