Foxn2 Peptide - N-terminal region
Foxn2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
3230402J05Rik, 6030465J18Rik, Fkh19, Foxn1, HTLF
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Foxn2 Rabbit Polyclonal Antibody (orb576350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_851305
Preservative
Lyophilized powder
AA Sequence
KRAETPGAEKVAGLSQIYKMGSLPEAGDAARPKATLVGSESADDELTNLN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP720440M 50 µg
LIMPII (SCARB2) (NM_005506) Human Recombinant Protein
Sign In for Pricing
View Details 
KN210750BN 1 Kit
galectin 9 (LGALS9) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
LC422193 20 µg
LIM kinase 2 (LIMK2) (NM_001031801) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC402765-500 1x 500 µL
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2765), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
