Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXN3 Peptide - middle region

FOXN3 Peptide - middle region

Product Specifications

Product Name Alternative

C14orf116, CHES1, PRO1635

UniProt

O00409

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXN3 Rabbit Polyclonal Antibody (orb583746) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005188

Preservative

Lyophilized powder

AA Sequence

EGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKKRQHFAKARKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-[ (Naphthalen-2-yl) amino]pyridine-3-carboxylic acid
TEC21623-01 50 mg

5-[ (Naphthalen-2-yl) amino]pyridine-3-carboxylic acid

Sign In for Pricing
View Details
5-[ (Naphthalen-2-yl) amino]pyridine-3-carboxylic acid
TEC21623-02 0.5 g

5-[ (Naphthalen-2-yl) amino]pyridine-3-carboxylic acid

Sign In for Pricing
View Details
Pkd2-set siRNA/shRNA/RNAi Lentivector (Mouse)
36871094 4x 500 ng

Pkd2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Recombinant Enterocytozoon bieneusi Fe-S cluster assembly protein DRE2 (DRE2)
MBS1229785-01 0.02 mg (E-Coli)

Recombinant Enterocytozoon bieneusi Fe-S cluster assembly protein DRE2 (DRE2)

Sign In for Pricing
View Details
Recombinant Enterocytozoon bieneusi Fe-S cluster assembly protein DRE2 (DRE2)
MBS1229785-02 0.1 mg (E-Coli)

Recombinant Enterocytozoon bieneusi Fe-S cluster assembly protein DRE2 (DRE2)

Sign In for Pricing
View Details
Recombinant Enterocytozoon bieneusi Fe-S cluster assembly protein DRE2 (DRE2)
MBS1229785-03 0.02 mg (Yeast)

Recombinant Enterocytozoon bieneusi Fe-S cluster assembly protein DRE2 (DRE2)

Sign In for Pricing
View Details