Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXO4 Peptide - C-terminal region

FOXO4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AFX, AFX1, MGC120490, MLLT7

UniProt

P98177

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXO4 Rabbit Polyclonal Antibody (orb574051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005929

Preservative

Lyophilized powder

AA Sequence

TPVLTPPTEAASQDRMPQDLDLDMYMENLECDMDNIISDLMDEGEGLDFN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GRF2 Antibody (OTI2F5) [Allophycocyanin]
NBP2-70846APC 0.1 mL

Mouse Monoclonal GRF2 Antibody (OTI2F5) [Allophycocyanin]

Sign In for Pricing
View Details
ME1 Antibody, FITC conjugated
CSB-PA013632LC01HU-01 50 µg

ME1 Antibody, FITC conjugated

Sign In for Pricing
View Details
ME1 Antibody, FITC conjugated
CSB-PA013632LC01HU-02 100 µg

ME1 Antibody, FITC conjugated

Sign In for Pricing
View Details
PE anti-mouse CD44
FC1124 100 Tests

PE anti-mouse CD44

Sign In for Pricing
View Details
CASP8 ELISA Kit (Mouse)
OKEH03437-96W 96 Well

CASP8 ELISA Kit (Mouse)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. Protease HtpX homolog (htpX), partial
MBS7063979 Inquire

Recombinant Mycobacterium sp. Protease HtpX homolog (htpX), partial

Sign In for Pricing
View Details