Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FPGS Peptide - middle region

FPGS Peptide - middle region

Product Specifications

UniProt

Q5JU19

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FPGS Rabbit Polyclonal Antibody (orb585645) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001018088

Preservative

Lyophilized powder

AA Sequence

CWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEWPGRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,8-Dichloro-6,12-diphenyldibenzo[b,f][1,5]diazocine
TRC-D434065-50MG 50 mg

2,8-Dichloro-6,12-diphenyldibenzo[b,f][1,5]diazocine

Sign In for Pricing
View Details
Cullin 5 (CUL5) (C-term) Rabbit Polyclonal Antibody
AP14229PU-N 400 µL

Cullin 5 (CUL5) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APC Anti-Mouse CD272 Antibody
RD20415F-01 25 µg

APC Anti-Mouse CD272 Antibody

Sign In for Pricing
View Details
APC Anti-Mouse CD272 Antibody
RD20415F-02 100 µg

APC Anti-Mouse CD272 Antibody

Sign In for Pricing
View Details
APC Anti-Mouse IFN-γ Antibody[XMG1.2]
E-AB-F1101UE-01 25 µg

APC Anti-Mouse IFN-γ Antibody[XMG1.2]

Sign In for Pricing
View Details
APC Anti-Mouse IFN-γ Antibody[XMG1.2]
E-AB-F1101UE-02 100 µg

APC Anti-Mouse IFN-γ Antibody[XMG1.2]

Sign In for Pricing
View Details