Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FPGS Peptide - middle region

FPGS Peptide - middle region

Product Specifications

UniProt

Q5JU19

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FPGS Rabbit Polyclonal Antibody (orb585645) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001018088

Preservative

Lyophilized powder

AA Sequence

CWLQRQDRHGAGEPKASRPGLLWQLPLAPVFQPTSHMRLGLRNTEWPGRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS700807 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human OR2W5P activation kit by CRISPRa
GA118533 1 Kit

Human OR2W5P activation kit by CRISPRa

Sign In for Pricing
View Details
Artemisic Acid
TRC-A777490-25MG 25 mg

Artemisic Acid

Sign In for Pricing
View Details
H-Met-Asp-OH
TRC-M222188-10MG 10 mg

H-Met-Asp-OH

Sign In for Pricing
View Details
Vitamin D3 Octanoate (90%)
TRC-V676105-50MG 50 mg

Vitamin D3 Octanoate (90%)

Sign In for Pricing
View Details
Ostruthin Imperatorin
TRC-O703908-2MG 2 mg

Ostruthin Imperatorin

Sign In for Pricing
View Details