Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FRG1L1 Peptide - middle region

FRG1L1 Peptide - middle region

Product Specifications

Product Name Alternative

Frg1

UniProt

D3ZRG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_001070964

Preservative

Lyophilized powder

AA Sequence

DEGSSPPEQFTAVKLSDSRIALKSGYGKYLGINSDGLVVGRSDAIGPREQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2'-Chloroacetophenone
TRC-C363815-5G 5 g

2'-Chloroacetophenone

Sign In for Pricing
View Details
c-Jun (JUN) Rabbit Polyclonal Antibody
TA392882 100 µL

c-Jun (JUN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Human VEGF165 (Vascular Endothelial Growth Factor 165) ELISA Kit
E-UNEL-H0179-01 5x 96 Tests

Uncoated Human VEGF165 (Vascular Endothelial Growth Factor 165) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human VEGF165 (Vascular Endothelial Growth Factor 165) ELISA Kit
E-UNEL-H0179-02 15x 96 Tests

Uncoated Human VEGF165 (Vascular Endothelial Growth Factor 165) ELISA Kit

Sign In for Pricing
View Details
LEPROTL1 (NM_015344) Human Over-expression Lysate
LY402424 100 µg

LEPROTL1 (NM_015344) Human Over-expression Lysate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Purified Antibody To Mouse IgG, (Min.x-rxn.),  40nm
GAF-443-40 1 mL

Colloidal Gold Conjugated Goat Purified Antibody To Mouse IgG, (Min.x-rxn.), 40nm

Sign In for Pricing
View Details