Frmd5 Peptide - N-terminal region
Frmd5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RGD1561554
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Frmd5 Rabbit Polyclonal Antibody (orb580994) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_230513
Preservative
Lyophilized powder
AA Sequence
FPKHSEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042148-500 1x 500 µL
Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Suppressor of Ty 4 homolog 1 (SUPT4H1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F12]](https://cdn.genprice.uk/products/937/6868c3bb994c49e6dc3fd38b/imageurl/ta803431am.webp)
TA803431AM 100 µL
Suppressor of Ty 4 homolog 1 (SUPT4H1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F12]
Sign In for Pricing
View Details