Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frmd5 Peptide - N-terminal region

Frmd5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1561554

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Frmd5 Rabbit Polyclonal Antibody (orb580994) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_230513

Preservative

Lyophilized powder

AA Sequence

FPKHSEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMO1 (NM_002315) Human Over-expression Lysate
LY419398 100 µg

LMO1 (NM_002315) Human Over-expression Lysate

Sign In for Pricing
View Details
Myelin PLP Chicken polyclonal Antibody
HA500573 100 µL

Myelin PLP Chicken polyclonal Antibody

Sign In for Pricing
View Details
Bis(4-hydroxybutyl) Terephthalate
TRC-B443815-50MG 50 mg

Bis(4-hydroxybutyl) Terephthalate

Sign In for Pricing
View Details
GSK3 beta (GSK3B) Mouse Monoclonal Antibody [Clone ID: 1F7]
AM09012PU-S 50 µL

GSK3 beta (GSK3B) Mouse Monoclonal Antibody [Clone ID: 1F7]

Sign In for Pricing
View Details
NAP1L3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]
TA808549BM 100 µL

NAP1L3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]

Sign In for Pricing
View Details
KDM5D Human Gene Knockout Kit (CRISPR)
KN418748 1 Kit

KDM5D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details