Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frmd6 Peptide - middle region

Frmd6 Peptide - middle region

Product Specifications

Product Name Alternative

Frmd6

UniProt

Q8VII0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_001064688

Preservative

Lyophilized powder

AA Sequence

ETDTKPRDPGPEDGYSGSVMHRKLKTCSSMTSHGSSHTSGVESGGKDRLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Centriole and Centrosome Antibody IgM ELISA Kit
MBS022982-01 48 Well

Mouse Centriole and Centrosome Antibody IgM ELISA Kit

Sign In for Pricing
View Details
Mouse Centriole and Centrosome Antibody IgM ELISA Kit
MBS022982-02 96 Well

Mouse Centriole and Centrosome Antibody IgM ELISA Kit

Sign In for Pricing
View Details
Mouse Centriole and Centrosome Antibody IgM ELISA Kit
MBS022982-03 5x 96 Well

Mouse Centriole and Centrosome Antibody IgM ELISA Kit

Sign In for Pricing
View Details
Mouse Centriole and Centrosome Antibody IgM ELISA Kit
MBS022982-04 10x 96 Well

Mouse Centriole and Centrosome Antibody IgM ELISA Kit

Sign In for Pricing
View Details
RAB27A Protein Vector (Human) (pPB-N-His)
PV056898 500 ng

RAB27A Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CD5, ID (CD5, LEU1, T-cell surface glycoprotein CD5, Lymphocyte antigen T1/Leu-1, CD5) (Azide free) (HRP) discontinued
033522-HRP 200 µL

CD5, ID (CD5, LEU1, T-cell surface glycoprotein CD5, Lymphocyte antigen T1/Leu-1, CD5) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details