FSCN3 Peptide - C-terminal region
FSCN3 Peptide - C-terminal region
Product Specifications
UniProt
Q9NQT6
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FSCN3 Rabbit Polyclonal Antibody (orb582203) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065102
Preservative
Lyophilized powder
AA Sequence
YDGEVRAASERLNRMSLFQFECDSESPTVQLRSANGYYLSQRRHRAVMAD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471037-500 1x 500 µL
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402044-100 1x 100 µL
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472651-500 1x 500 µL
Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470668-500 1x 500 µL
MART-1 / Melan-A (A103), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details