Fto Peptide - N-terminal region
Fto Peptide - N-terminal region
Product Specifications
Product Name Alternative
AW743446, mKIAA1752
UniProt
Q8BGW1
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fto Rabbit Polyclonal Antibody (orb330511) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036066
Preservative
Lyophilized powder
AA Sequence
MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC403795-100 1x 100 µL
GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC743771-500 1x 500 µL
Ferritin, Light Chain (Node-Negative Breast Tumor Prognostic Marker) (rFTL/1388), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![TNFRSF14 Mouse Monoclonal Antibody [Clone ID: OTI7F1]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908f7c/imageurl/cf813628.webp)
CF813628 100 µg
TNFRSF14 Mouse Monoclonal Antibody [Clone ID: OTI7F1]
Sign In for Pricing
View Details 