Fto Peptide - N-terminal region
Fto Peptide - N-terminal region
Product Specifications
Product Name Alternative
AW743446, mKIAA1752
UniProt
Q8BGW1
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fto Rabbit Polyclonal Antibody (orb330511) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036066
Preservative
Lyophilized powder
AA Sequence
MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP762410 50 µg
BRN3A (POU4F1) (NM_006237) Human Recombinant Protein
Sign In for Pricing
View Details 
LY424628 100 µg
IL1RA (IL1RN) (NM_000577) Human Over-expression Lysate
Sign In for Pricing
View Details 
GF-PT-K 25 Preparations
GF-1 Plant Starter Kit / Taq DNA Polymerase, 25 preps
Sign In for Pricing
View Details