Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTO Peptide - middle region

FTO Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1752, MGC5149

UniProt

Q9C0B1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FTO Rabbit Polyclonal Antibody (orb330512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073901

Preservative

Lyophilized powder

AA Sequence

WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O81 (strain ED1a) SELA Polyclonal Antibody
MBS7174112 Inquire

Rabbit anti-Escherichia coli O81 (strain ED1a) SELA Polyclonal Antibody

Sign In for Pricing
View Details
IFluor® A7 Anti-human CD22 Antibody *HIB22*
102200S0-AAT 100 Tests

IFluor® A7 Anti-human CD22 Antibody *HIB22*

Sign In for Pricing
View Details
MCPH1 ORF Vector (Human) (pORF)
28241011 1.0 µg DNA

MCPH1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
L-Ornithine Hydrochloride discontinued. See O8030
018827 5 g

L-Ornithine Hydrochloride discontinued. See O8030

Sign In for Pricing
View Details
Rat NOB1 shRNA Plasmid
abx988546-01 150 µg

Rat NOB1 shRNA Plasmid

Sign In for Pricing
View Details
Rat NOB1 shRNA Plasmid
abx988546-02 300 µg

Rat NOB1 shRNA Plasmid

Sign In for Pricing
View Details