Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTO Peptide - middle region

FTO Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1752, MGC5149

UniProt

Q9C0B1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FTO Rabbit Polyclonal Antibody (orb330512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073901

Preservative

Lyophilized powder

AA Sequence

WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Lgr6 Pre-designed siRNA Set A
SI107530A 1 Each

Mouse Lgr6 Pre-designed siRNA Set A

Sign In for Pricing
View Details
OR52I2 siRNA (h)
sc-97008 10 µM

OR52I2 siRNA (h)

Sign In for Pricing
View Details
Olfr614 siRNA (m)
sc-150985 10 µM

Olfr614 siRNA (m)

Sign In for Pricing
View Details
Epidermal Growth Factor Receptor (erbB, EGFR), Extracellular Domain (BSA & Azide Free) (FITC)
MBS6266442-01 0.1 mL

Epidermal Growth Factor Receptor (erbB, EGFR), Extracellular Domain (BSA & Azide Free) (FITC)

Sign In for Pricing
View Details
Epidermal Growth Factor Receptor (erbB, EGFR), Extracellular Domain (BSA & Azide Free) (FITC)
MBS6266442-02 5x 0.1 mL

Epidermal Growth Factor Receptor (erbB, EGFR), Extracellular Domain (BSA & Azide Free) (FITC)

Sign In for Pricing
View Details
Rat C1qa Pre-designed siRNA Set A
SI201701A 1 Each

Rat C1qa Pre-designed siRNA Set A

Sign In for Pricing
View Details