Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ftsj3 Peptide - C-terminal region

Ftsj3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ftsj3

UniProt

Q5RJT2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ftsj3 Rabbit Polyclonal Antibody (orb580529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012014

Preservative

Lyophilized powder

AA Sequence

QVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQRKEQKRNHRRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXW4 Polyclonal Antibody
E-AB-67953-01 60 µL

FBXW4 Polyclonal Antibody

Sign In for Pricing
View Details
FBXW4 Polyclonal Antibody
E-AB-67953-02 120 µL

FBXW4 Polyclonal Antibody

Sign In for Pricing
View Details
FBXW4 Polyclonal Antibody
E-AB-67953-03 200 µL

FBXW4 Polyclonal Antibody

Sign In for Pricing
View Details
CD45 / LCA (136-4B5), 0.2mg/mL
BNUB0173-500 1x 500 µL

CD45 / LCA (136-4B5), 0.2mg/mL

Sign In for Pricing
View Details
Human IL-21 Recombinant Mouse monoclonal Antibody
HA601358B 100 µL

Human IL-21 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
1,2-Bis(4-(benzo[d]oxazol-2-yl)phenyl)ethene
TRC-B410525-500MG 500 mg

1,2-Bis(4-(benzo[d]oxazol-2-yl)phenyl)ethene

Sign In for Pricing
View Details