Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ftsj3 Peptide - C-terminal region

Ftsj3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ftsj3

UniProt

Q5RJT2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ftsj3 Rabbit Polyclonal Antibody (orb580529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012014

Preservative

Lyophilized powder

AA Sequence

QVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQRKEQKRNHRRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMARCE1 Rabbit Monoclonal Antibody
TA424005 100 µL

SMARCE1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CBX8 (NM_020649) Human Recombinant Protein
TP762079 50 µg

CBX8 (NM_020649) Human Recombinant Protein

Sign In for Pricing
View Details
TNFRSF4 Mouse Monoclonal Antibody [Clone ID: OTI2B7]
CF812371 100 µg

TNFRSF4 Mouse Monoclonal Antibody [Clone ID: OTI2B7]

Sign In for Pricing
View Details
1-(2,2-Difluoro-1,3-benzodioxol-5-yl)propan-2-amine
TRC-D302585-1G 1 g

1-(2,2-Difluoro-1,3-benzodioxol-5-yl)propan-2-amine

Sign In for Pricing
View Details
CDC25C Rabbit Polyclonal Antibody
AP02408PU-S 50 µL

CDC25C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), Biotin conjugate, 0.1mg/mL
BNCB2886-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details