Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FUT1 Peptide - middle region

FUT1 Peptide - middle region

Product Specifications

Product Name Alternative

H, HH, HSC

UniProt

P19526

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FUT1 Rabbit Polyclonal Antibody (orb579092) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000139

Preservative

Lyophilized powder

AA Sequence

EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GALNT8 activation kit by CRISPRa
GA108849 1 Kit

Human GALNT8 activation kit by CRISPRa

Sign In for Pricing
View Details
RPAP3 Human Gene Knockout Kit (CRISPR)
KN423187 1 Kit

RPAP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), Biotin conjugate, 0.1mg/mL
BNCB2571-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), CF568 conjugate, 0.1mg/mL
BNC681991-500 1x 500 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC Class I Antibody
KC-31294-01 50 μL

MHC Class I Antibody

Sign In for Pricing
View Details
MHC Class I Antibody
KC-31294-02 100 µL

MHC Class I Antibody

Sign In for Pricing
View Details