Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fxn Peptide - middle region

Fxn Peptide - middle region

Product Specifications

Product Name Alternative

FA, FARR, Frda, X25

UniProt

O35943

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fxn Rabbit Polyclonal Antibody (orb580238) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032070

Preservative

Lyophilized powder

AA Sequence

TLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GINS1 Pre-designed siRNA Set A
SI006245A 1 Each

Human GINS1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
LOC685064 3'UTR Luciferase Stable Cell Line
TU211175 1.0 mL

LOC685064 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CTNND1 Antibody
MBS2524951-01 0.06 mL

CTNND1 Antibody

Sign In for Pricing
View Details
CTNND1 Antibody
MBS2524951-02 0.12 mL

CTNND1 Antibody

Sign In for Pricing
View Details
CTNND1 Antibody
MBS2524951-03 0.2 mL

CTNND1 Antibody

Sign In for Pricing
View Details
CTNND1 Antibody
MBS2524951-04 5x 0.2 mL

CTNND1 Antibody

Sign In for Pricing
View Details