Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fxn Peptide - C-terminal region

Fxn Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1565754, Fxn

UniProt

D3ZYW7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fxn Rabbit Polyclonal Antibody (orb581305) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_001078791

Preservative

Lyophilized powder

AA Sequence

EFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N, N-Carbonyldiimidazole (CDI) extrapure AR, 98%
67852-01 25 g

N, N-Carbonyldiimidazole (CDI) extrapure AR, 98%

Sign In for Pricing
View Details
N, N-Carbonyldiimidazole (CDI) extrapure AR, 98%
67852-02 100 g

N, N-Carbonyldiimidazole (CDI) extrapure AR, 98%

Sign In for Pricing
View Details
N, N-Carbonyldiimidazole (CDI) extrapure AR, 98%
67852-03 500 g

N, N-Carbonyldiimidazole (CDI) extrapure AR, 98%

Sign In for Pricing
View Details
Docking Protein 2 (DOK2) Antibody (Biotin)
abx312688-01 20 µg

Docking Protein 2 (DOK2) Antibody (Biotin)

Sign In for Pricing
View Details
Docking Protein 2 (DOK2) Antibody (Biotin)
abx312688-02 50 µg

Docking Protein 2 (DOK2) Antibody (Biotin)

Sign In for Pricing
View Details
Docking Protein 2 (DOK2) Antibody (Biotin)
abx312688-03 100 µg

Docking Protein 2 (DOK2) Antibody (Biotin)

Sign In for Pricing
View Details