Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G6B, Human (HEK293, His)

The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

G6B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g6b-protein-human-hek293-his.html

Purity

95.60

Smiles

NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ

Molecular Formula

80739 (Gene_ID) O95866-1/NP_612116.1 (N18-Q142) (Accession)

Molecular Weight

Approximately 18-23 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse monoclonal antibody to Human, Mouse, Bovine, Chicken TGF-B1,2,3 (Clone 1D11.1)
MBS378340-01 0.5 mg

Mouse monoclonal antibody to Human, Mouse, Bovine, Chicken TGF-B1,2,3 (Clone 1D11.1)

Sign In for Pricing
View Details
Mouse monoclonal antibody to Human, Mouse, Bovine, Chicken TGF-B1,2,3 (Clone 1D11.1)
MBS378340-02 5x 0.5 mg

Mouse monoclonal antibody to Human, Mouse, Bovine, Chicken TGF-B1,2,3 (Clone 1D11.1)

Sign In for Pricing
View Details
Lentiviral human XIRP2 shRNA (UAS) - Lentiviral human XIRP2 shRNA (UAS, iRFP) (100)
GTR15088779 1 Vial

Lentiviral human XIRP2 shRNA (UAS) - Lentiviral human XIRP2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Cyp4f14 (NM_022434) Mouse Tagged ORF Clone
MR208397 10 µg

Cyp4f14 (NM_022434) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Slc1a3 3'UTR Lenti-reporter-Luc Vector
43924084 1.0 µg

Slc1a3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Lentiviral mouse Epha6 shRNA (UAS) - Lentiviral mouse Epha6 shRNA (UAS, iRFP) (100)
GTR15273231 1 Vial

Lentiviral mouse Epha6 shRNA (UAS) - Lentiviral mouse Epha6 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details