Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G6B, Human (HEK293, His)

The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

G6B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g6b-protein-human-hek293-his.html

Purity

95.60

Smiles

NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ

Molecular Formula

80739 (Gene_ID) O95866-1/NP_612116.1 (N18-Q142) (Accession)

Molecular Weight

Approximately 18-23 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hmgcs1 Antibody, HRP conjugated
A61060-50UG 50 µg

Hmgcs1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Human DAND5 Knockout A549 cell line
GTR15403511 1 Vial

Human DAND5 Knockout A549 cell line

Sign In for Pricing
View Details
TUBD1 Protein Vector (Rat) (pPB-C-His)
PV313730 500 ng

TUBD1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Anti-CD22 Antibody, Rabbit Polyclonal
MBS8113095-01 0.1 mL

Anti-CD22 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-CD22 Antibody, Rabbit Polyclonal
MBS8113095-02 5x 0.1 mL

Anti-CD22 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Rabbit anti-Zea mays (Maize) PURA Polyclonal Antibody
MBS7180713 Inquire

Rabbit anti-Zea mays (Maize) PURA Polyclonal Antibody

Sign In for Pricing
View Details