G6B, Human (HEK293, His)
The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
G6B Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/g6b-protein-human-hek293-his.html
Purity
95.60
Smiles
NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ
Molecular Formula
80739 (Gene_ID) O95866-1/NP_612116.1 (N18-Q142) (Accession)
Molecular Weight
Approximately 18-23 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Recombinant Rickettsia canadensis Prolipoprotein diacylglyceryl transferase (lgt), partial
Annexin V-APC Apoptosis Detection Kit (Annexin V-APC / 7-AAD)
PPM1F (Protein Phosphatase 1F, Ca (2+) /Calmodulin-dependent Protein Kinase Phosphatase, CaM-kinase Phosphatase, CaMKPase, Partner of PIX 2, Protein fem-2 Homolog, hFem-2, KIAA0015, POPX2) (PE)
CD11a (Integrin Alpha L, ITGAL, Leukocyte Adhesion Glycoprotein LFA1 Alpha Chain, LFA1A, Ly15, Ly21, Lymphocyte Function Associated Antigen Type 1 alpha, p180) (FITC) discontinued