Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G6B, Human (HEK293, His)

The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

G6B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g6b-protein-human-hek293-his.html

Purity

95.60

Smiles

NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ

Molecular Formula

80739 (Gene_ID) O95866-1/NP_612116.1 (N18-Q142) (Accession)

Molecular Weight

Approximately 18-23 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P38 MAPK, phosphorylated (Thr180/Tyr182)
045925 200 µL

P38 MAPK, phosphorylated (Thr180/Tyr182)

Sign In for Pricing
View Details
Calml4 3'UTR GFP Stable Cell Line
TU153062 1.0 mL

Calml4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Pseudolaric Acid B
2512-1 1 mg

Pseudolaric Acid B

Sign In for Pricing
View Details
SUMO2 (Small Ubiquitin-related Modifier 2, SUMO-2, HSMT3, SMT3 Homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A, Smt3A, SMT3A, SMT3H2) (MaxLight 650)
134091-ML650 100 µL

SUMO2 (Small Ubiquitin-related Modifier 2, SUMO-2, HSMT3, SMT3 Homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A, Smt3A, SMT3A, SMT3H2) (MaxLight 650)

Sign In for Pricing
View Details
FUCA1 sgRNA CRISPR Lentivector (Human) (Target 1)
K0821002 1.0 µg DNA

FUCA1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Anti-Human IgG F (ab') ? Secondary Antibody-PE
MF-0011545-01 100 µL

Rabbit Anti-Human IgG F (ab') ? Secondary Antibody-PE

Sign In for Pricing
View Details