Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G6B, Human (HEK293, His)

The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

G6B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g6b-protein-human-hek293-his.html

Purity

95.60

Smiles

NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ

Molecular Formula

80739 (Gene_ID) O95866-1/NP_612116.1 (N18-Q142) (Accession)

Molecular Weight

Approximately 18-23 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD38 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C9]
TA804538BM 100 µL

CD38 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C9]

Sign In for Pricing
View Details
Recombinant Bordetella Avium cheB1 Protein (aa 1-342)
VAng-Lsx4142-1mgEcoli 1 mg (E. coli)

Recombinant Bordetella Avium cheB1 Protein (aa 1-342)

Sign In for Pricing
View Details
PPIL6 Mouse Monoclonal Antibody [Clone ID: LBI4C1]
AMM12727VCF 100 µg

PPIL6 Mouse Monoclonal Antibody [Clone ID: LBI4C1]

Sign In for Pricing
View Details
Lentiviral human NUBPL shRNA (UAS) - Lentiviral human NUBPL shRNA (UAS, GFP) (100)
GTR15308280 1 Vial

Lentiviral human NUBPL shRNA (UAS) - Lentiviral human NUBPL shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Lentiviral mouse Map3k15 shRNA (UAS) - Lentiviral mouse Map3k15 shRNA (UAS, iRFP) (100)
GTR15285579 1 Vial

Lentiviral mouse Map3k15 shRNA (UAS) - Lentiviral mouse Map3k15 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Mouse Neurturin (NRTN) ELISA Kit
abx521195 96 Tests

Mouse Neurturin (NRTN) ELISA Kit

Sign In for Pricing
View Details