Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G6B, Human (HEK293, His)

The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

G6B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g6b-protein-human-hek293-his.html

Purity

95.60

Smiles

NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ

Molecular Formula

80739 (Gene_ID) O95866-1/NP_612116.1 (N18-Q142) (Accession)

Molecular Weight

Approximately 18-23 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPF19 Antibody (N-term) [APR32093G]
APR32093G-01 50 µL

PRPF19 Antibody (N-term) [APR32093G]

Sign In for Pricing
View Details
PRPF19 Antibody (N-term) [APR32093G]
APR32093G-02 100 µL

PRPF19 Antibody (N-term) [APR32093G]

Sign In for Pricing
View Details
PRPF19 Antibody (N-term) [APR32093G]
APR32093G-03 200 µL

PRPF19 Antibody (N-term) [APR32093G]

Sign In for Pricing
View Details
PRPF19 Antibody (N-term) [APR32093G]
APR32093G-04 400 µL

PRPF19 Antibody (N-term) [APR32093G]

Sign In for Pricing
View Details
Clostridium difficile Toxin B Antibody
abx120036 1 mg

Clostridium difficile Toxin B Antibody

Sign In for Pricing
View Details
Rat Potassium voltage-gated channel subfamily H member 1, KCNH1 ELISA Kit
MBS9320952-01 48 Well

Rat Potassium voltage-gated channel subfamily H member 1, KCNH1 ELISA Kit

Sign In for Pricing
View Details