Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G6B, Human (HEK293, His)

The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

G6B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g6b-protein-human-hek293-his.html

Purity

95.60

Smiles

NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ

Molecular Formula

80739 (Gene_ID) O95866-1/NP_612116.1 (N18-Q142) (Accession)

Molecular Weight

Approximately 18-23 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Recql5 qPCR Primer Pair
QM52330S 200 Tests

Mouse Recql5 qPCR Primer Pair

Sign In for Pricing
View Details
E2F4 (Transcription Factor E2F4, E2F-4) (HRP)
029459-HRP 100 µL

E2F4 (Transcription Factor E2F4, E2F-4) (HRP)

Sign In for Pricing
View Details
ADRB2, phosphorylated (Ser261) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR , Adrenergic, beta-2-, Receptor, Surface) (MaxLight 490) discontinued
A0906-88D-ML490 100 µL

ADRB2, phosphorylated (Ser261) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR , Adrenergic, beta-2-, Receptor, Surface) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal xCT Antibody [Allophycocyanin]
NB300-318APC 0.1 mL

Rabbit Polyclonal xCT Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Rat Monoclonal CD34 Antibody (700011) [Janelia Fluor 549]
FAB6518I 0.1 mL

Rat Monoclonal CD34 Antibody (700011) [Janelia Fluor 549]

Sign In for Pricing
View Details
Patj (NM_007704) Mouse Tagged ORF Clone Lentiviral Particle
MR222654L3V 200 µL

Patj (NM_007704) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details