Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G6B, Human (HEK293, His)

The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

G6B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g6b-protein-human-hek293-his.html

Purity

95.60

Smiles

NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ

Molecular Formula

80739 (Gene_ID) O95866-1/NP_612116.1 (N18-Q142) (Accession)

Molecular Weight

Approximately 18-23 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkbh5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3245005 3x 1.0 µg

Alkbh5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PTEN (Ab-370)
ANTY021057 100ug

PTEN (Ab-370)

Sign In for Pricing
View Details
Echinococcus IgG Control Serum
C107G 3 mL

Echinococcus IgG Control Serum

Sign In for Pricing
View Details
Human Anti-cytochrome P450c21/21-hydroxylase antibody (CYP21B-Ab) ELISA Kit
MBS284487-01 48 Tests

Human Anti-cytochrome P450c21/21-hydroxylase antibody (CYP21B-Ab) ELISA Kit

Sign In for Pricing
View Details
Human Anti-cytochrome P450c21/21-hydroxylase antibody (CYP21B-Ab) ELISA Kit
MBS284487-02 96 Tests

Human Anti-cytochrome P450c21/21-hydroxylase antibody (CYP21B-Ab) ELISA Kit

Sign In for Pricing
View Details
Human Anti-cytochrome P450c21/21-hydroxylase antibody (CYP21B-Ab) ELISA Kit
MBS284487-03 5x 96 Tests

Human Anti-cytochrome P450c21/21-hydroxylase antibody (CYP21B-Ab) ELISA Kit

Sign In for Pricing
View Details