G6B, Human (HEK293, His)
The G6B protein is an inhibitory receptor critical for hematopoietic lineage differentiation, megakaryocyte function, and platelet production. Its effects include inhibiting platelet aggregation and activation induced by agonists such as ADP and collagen-related peptides. G6B Protein, Human (HEK293, His) is the recombinant human-derived G6B protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
G6B Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/g6b-protein-human-hek293-his.html
Purity
95.60
Smiles
NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ
Molecular Formula
80739 (Gene_ID) O95866-1/NP_612116.1 (N18-Q142) (Accession)
Molecular Weight
Approximately 18-23 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
SLC38A3, ID (Sodium-coupled Neutral Amino Acid Transporter 3, Na (+) -coupled Neutral Amino Acid Transporter 3, System N Amino Acid Transporter 1, N-system Amino Acid Transporter 1, Solute Carrier Family 38 Member 3, SNAT3, SN1, NAT1, G17) (MaxLight 550) discontinued
