Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AdmiRa-Off-hsa-miR-4768-5p Virus

Product Specifications

Gene Name

hsa-miR-4768-5p

Accession Number

MIMAT0019920

Reactivity

Human (H. sapiens)

Vector Name

pAdeno-mir-GFP

Shipping Conditions

High titer adenoviruses are shipped with dry ice and low titer adenoviruses are shipped with ice packs. For long term storage, it is recommended to store the viruses at -80°C in small aliquots to avoid repeated freeze-thaw cycles.
More Discoveries

Explore Other Products

Browse additional items from our catalog

ING3 (Inhibitor of Growth Family, Member 3, Eaf4, FLJ20089, ING2, p47ING3) (AP) discontinued
247657-AP 100 µL

ING3 (Inhibitor of Growth Family, Member 3, Eaf4, FLJ20089, ING2, p47ING3) (AP) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal PDGF R beta Antibody (18A2) [DyLight 405]
NBP1-47232V 0.1 mL

Mouse Monoclonal PDGF R beta Antibody (18A2) [DyLight 405]

Sign In for Pricing
View Details
OTTMUSG00000017363 siRNA (m)
sc-151822 10 µM

OTTMUSG00000017363 siRNA (m)

Sign In for Pricing
View Details
PCMV-lyso-pHluorin Plasmid
PVT64262 2 µg

PCMV-lyso-pHluorin Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal SCAMP4 Antibody [Alexa Fluor 405]
NBP2-81787AF405 0.1 mL

Rabbit Polyclonal SCAMP4 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details