Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM3D, Human (HEK293, His)

FAM3D Protein exhibits high expression in the placenta but has low expression levels in the small intestine. FAM3D Protein, Human (199a.a, HEK293, His) is the recombinant human-derived FAM3D protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FAM3D Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fam3d-protein-human-hek-293-his.html

Purity

98.0

Smiles

YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPF

Molecular Formula

131177 (Gene_ID) Q96BQ1 (Y26-F224) (Accession)

Molecular Weight

Approximately 26 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3.1 / HIST1H3A (H3C1) Antibody
abx343340-01 20 µL

Histone H3.1 / HIST1H3A (H3C1) Antibody

Sign In for Pricing
View Details
Histone H3.1 / HIST1H3A (H3C1) Antibody
abx343340-02 50 µL

Histone H3.1 / HIST1H3A (H3C1) Antibody

Sign In for Pricing
View Details
Histone H3.1 / HIST1H3A (H3C1) Antibody
abx343340-03 100 µL

Histone H3.1 / HIST1H3A (H3C1) Antibody

Sign In for Pricing
View Details
Histone H3.1 / HIST1H3A (H3C1) Antibody
abx343340-04 200 µL

Histone H3.1 / HIST1H3A (H3C1) Antibody

Sign In for Pricing
View Details
Histone H3.1 / HIST1H3A (H3C1) Antibody
abx343340-05 1 mL

Histone H3.1 / HIST1H3A (H3C1) Antibody

Sign In for Pricing
View Details
Bovine Interleukin 1 Alpha (IL1a) ELISA Kit
DLR-IL1a-b-96T 96 Tests

Bovine Interleukin 1 Alpha (IL1a) ELISA Kit

Sign In for Pricing
View Details