Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GNT2, Human (HEK293, Fc)

The B3GNT2 protein is a member of the zinc-containing alcohol dehydrogenase family and facilitates the oxidation of alcohols to their corresponding carbonyl compounds. This enzyme is widely distributed in organisms, has zinc ions in its active site, and catalyzes substrate conversion through dehydrogenation. B3GNT2 Protein, Human (HEK293, Fc) is the recombinant human-derived B3GNT2 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

B3GNT2 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b3gnt2-protein-human-hek293-fc.html

Purity

95

Smiles

KSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC

Molecular Formula

10678 (Gene_ID) Q9NY97-1 (K29-C397) (Accession)

Molecular Weight

Approximately 80-160 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP10 antibody
70R-35237 0.1 mg

LRP10 antibody

Sign In for Pricing
View Details
Wingless Type MMTV Integration Site Family, Member 3 (WNT3) BioAssayTM ELISA Kit (Human) discontinued
028928-01 48 Tests

Wingless Type MMTV Integration Site Family, Member 3 (WNT3) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Wingless Type MMTV Integration Site Family, Member 3 (WNT3) BioAssayTM ELISA Kit (Human) discontinued
028928-02 96 Tests

Wingless Type MMTV Integration Site Family, Member 3 (WNT3) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Slide Mailer from Plasticware cat Material: Polypropylene 2 slides
5050750/2 1 Each

Slide Mailer from Plasticware cat Material: Polypropylene 2 slides

Sign In for Pricing
View Details
IL5 Polyclonal Antibody
MBS9434137-01 0.05 mL

IL5 Polyclonal Antibody

Sign In for Pricing
View Details
IL5 Polyclonal Antibody
MBS9434137-02 0.1 mL

IL5 Polyclonal Antibody

Sign In for Pricing
View Details