Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL17D Peptide - N-terminal region

IL17D Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ30846, IL-17D, IL-22, IL-27, IL27

UniProt

Q8TAD2

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL17D Rabbit Polyclonal Antibody (orb583685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612141

Preservative

Lyophilized powder

AA Sequence

MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPN3 Antibody - C-terminal region : FITC (ARP62840_P050-FITC)
ARP62840_P050-FITC 100 µL

GPN3 Antibody - C-terminal region : FITC (ARP62840_P050-FITC)

Sign In for Pricing
View Details
Motavizumab Biosimilar, Research Grade
ABS-392-100ug 100 µg

Motavizumab Biosimilar, Research Grade

Sign In for Pricing
View Details
Boldenone Acetate-d3
TRC-B675157-5MG 5 mg

Boldenone Acetate-d3

Sign In for Pricing
View Details
SOX2 Antibody
orb1261824 100 µL

SOX2 Antibody

Sign In for Pricing
View Details
Polystyrene Particles Conjugated to Cy5 (50 nm)
B2013326 0.5 mL

Polystyrene Particles Conjugated to Cy5 (50 nm)

Sign In for Pricing
View Details
Trabectedin
C12924 1 mg

Trabectedin

Sign In for Pricing
View Details