Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL17D Peptide - N-terminal region

IL17D Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ30846, IL-17D, IL-22, IL-27, IL27

UniProt

Q8TAD2

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL17D Rabbit Polyclonal Antibody (orb583685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612141

Preservative

Lyophilized powder

AA Sequence

MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Angiopoietin-like protein 8/Betatrophin Antibody (OTI1B12) [CoraFluor 1]
NBP2-72046CL1 0.1 mL

Mouse Monoclonal Angiopoietin-like protein 8/Betatrophin Antibody (OTI1B12) [CoraFluor 1]

Sign In for Pricing
View Details
FH Antibody
E30AC1939 100 µL

FH Antibody

Sign In for Pricing
View Details
OR2N1P Protein Vector (Human) (pPM-C-HA)
PV106652 500 ng

OR2N1P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human PRPF3 Pre-designed siRNA Set B
SI012886B 1 Each

Human PRPF3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
2,2,2-Trifluoroethyl Carbonochloridate
RG-A263130-01 10 mg

2,2,2-Trifluoroethyl Carbonochloridate

Sign In for Pricing
View Details
2,2,2-Trifluoroethyl Carbonochloridate
RG-A263130-02 25 mg

2,2,2-Trifluoroethyl Carbonochloridate

Sign In for Pricing
View Details