Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Npas2 Peptide - middle region

Npas2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC129355, MOP4, bHLHe9

UniProt

P97460

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Npas2 Rabbit Polyclonal Antibody (orb576157) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032745

Preservative

Lyophilized powder

AA Sequence

VSYADVRVERRQELALEDPPTEAMHPSAVKEKDSSLEPPQPFNALDMGAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNG4 Antibody
orb1555119-01 50 μL

GNG4 Antibody

Sign In for Pricing
View Details
GNG4 Antibody
orb1555119-02 100 µL

GNG4 Antibody

Sign In for Pricing
View Details
GNG4 Antibody
orb1555119-03 200 µL

GNG4 Antibody

Sign In for Pricing
View Details
Recombinant Centromere Protein H (CENPH)
MBS2031069-01 0.01 mg

Recombinant Centromere Protein H (CENPH)

Sign In for Pricing
View Details
Recombinant Centromere Protein H (CENPH)
MBS2031069-02 0.05 mg

Recombinant Centromere Protein H (CENPH)

Sign In for Pricing
View Details
Recombinant Centromere Protein H (CENPH)
MBS2031069-03 0.1 mg

Recombinant Centromere Protein H (CENPH)

Sign In for Pricing
View Details