Npas2 Peptide - middle region
Npas2 Peptide - middle region
Product Specifications
Product Name Alternative
MGC129355, MOP4, bHLHe9
UniProt
P97460
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Npas2 Rabbit Polyclonal Antibody (orb576157) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032745
Preservative
Lyophilized powder
AA Sequence
VSYADVRVERRQELALEDPPTEAMHPSAVKEKDSSLEPPQPFNALDMGAS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1422303-01 0.5 mg (E-Coli)
Recombinant Arabidopsis thaliana Vesicle-associated protein 1-3 (PVA13), partial
Sign In for Pricing
View Details MBS1422303-02 0.05 mg (Baculovirus)
Recombinant Arabidopsis thaliana Vesicle-associated protein 1-3 (PVA13), partial
Sign In for Pricing
View Details MBS1422303-03 0.5 mg (Yeast)
Recombinant Arabidopsis thaliana Vesicle-associated protein 1-3 (PVA13), partial
Sign In for Pricing
View Details MBS1422303-04 0.05 mg (Mammalian-Cell)
Recombinant Arabidopsis thaliana Vesicle-associated protein 1-3 (PVA13), partial
Sign In for Pricing
View Details MBS1422303-05 1 mg (E-Coli)
Recombinant Arabidopsis thaliana Vesicle-associated protein 1-3 (PVA13), partial
Sign In for Pricing
View Details MBS1422303-06 0.1 mg (Baculovirus)
Recombinant Arabidopsis thaliana Vesicle-associated protein 1-3 (PVA13), partial
Sign In for Pricing
View Details