Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tal2 Peptide - middle region

Tal2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC130117, bHLHa19

UniProt

Q62282

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tal2 Rabbit Polyclonal Antibody (orb324672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033343

Preservative

Lyophilized powder

AA Sequence

INFLVKVLGEQSLHQTGVAAQGNILGLFPPKTRLPDEDDRTLLNDYRVPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human HSD3B7 pAb
PA11235-01 50 μL

Rabbit Anti-Human HSD3B7 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human HSD3B7 pAb
PA11235-02 100 μL

Rabbit Anti-Human HSD3B7 pAb

Sign In for Pricing
View Details
PKAγ cat siRNA (h)
sc-36236 10 µM

PKAγ cat siRNA (h)

Sign In for Pricing
View Details
Atg4a Rat Pre-designed siRNA Set A
HY-RS25662 1 Set

Atg4a Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
IL6 rat monoclonal antibody, clone MQ2-39C3, Purified
AM05404PU-N 500 µg

IL6 rat monoclonal antibody, clone MQ2-39C3, Purified

Sign In for Pricing
View Details
Translin (TSN) Mouse Monoclonal Antibody [Clone ID: LBI4C6]
AMM18840VCF 100 µg

Translin (TSN) Mouse Monoclonal Antibody [Clone ID: LBI4C6]

Sign In for Pricing
View Details