Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tal2 Peptide - middle region

Tal2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC130117, bHLHa19

UniProt

Q62282

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tal2 Rabbit Polyclonal Antibody (orb324672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033343

Preservative

Lyophilized powder

AA Sequence

INFLVKVLGEQSLHQTGVAAQGNILGLFPPKTRLPDEDDRTLLNDYRVPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystatin-C Recombinant Antibody, HRP Conjugated
bsm-61363R-HRP-01 20 µL

Cystatin-C Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Cystatin-C Recombinant Antibody, HRP Conjugated
bsm-61363R-HRP-02 100 µL

Cystatin-C Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Suppressin (A-7) : m-IgG Fc BP-HRP Bundle
sc-540578 1 Kit

Suppressin (A-7) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Recombinant Danio rerio Cyclin-F (ccnf), partial
MBS1358601 Inquire

Recombinant Danio rerio Cyclin-F (ccnf), partial

Sign In for Pricing
View Details
PDK1 Antibody
orb69369 100 µL

PDK1 Antibody

Sign In for Pricing
View Details
XEN103
T71745-01 25 mg

XEN103

Sign In for Pricing
View Details