A2BP1 Peptide - N-terminal region
A2BP1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FOX1, HRNBP1, 2BP1, A2BP1, FOX-1
UniProt
Q9NWB1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with A2BP1 Rabbit Polyclonal Antibody (orb577831) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_061193
Preservative
Lyophilized powder
AA Sequence
SAQTVSGTATQTDDAAPTDGQPQTQPSENTENKSQPKRLHVSNIPFRFRD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041577-100 1x 100 µL
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC743309-100 1x 100 µL
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3309), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941983-500 1x 500 µL
Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details