Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A2BP1 Peptide - N-terminal region

A2BP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FOX1, HRNBP1, 2BP1, A2BP1, FOX-1

UniProt

Q9NWB1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with A2BP1 Rabbit Polyclonal Antibody (orb577831) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061193

Preservative

Lyophilized powder

AA Sequence

SAQTVSGTATQTDDAAPTDGQPQTQPSENTENKSQPKRLHVSNIPFRFRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neoponcirin
TRC-N390050-50MG 50 mg

Neoponcirin

Sign In for Pricing
View Details
PAK4 (NM_001014831) Human Recombinant Protein
TP306847L 1 mg

PAK4 (NM_001014831) Human Recombinant Protein

Sign In for Pricing
View Details
MRP5 (ABCC5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B1]
TA808368BM 100 µL

MRP5 (ABCC5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B1]

Sign In for Pricing
View Details
PRMT5 (NM_001039619) Human Over-expression Lysate
LC422095 20 µg

PRMT5 (NM_001039619) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB503712 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Recombinant Human UBE2W Protein (His Tag)
PKSH030788 100 µg

Recombinant Human UBE2W Protein (His Tag)

Sign In for Pricing
View Details