ABHD12B Peptide - middle region
ABHD12B Peptide - middle region
Product Specifications
Product Name Alternative
BEM46L3, C14orf29, MGC129926, MGC129927, c14_5314
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ABHD12B Rabbit Polyclonal Antibody (orb582058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_853511
Preservative
Lyophilized powder
AA Sequence
ARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVAS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6365346-01 0.1 mL
ZIC1, NT (ZIC1, ZIC, ZNF201, Zinc finger protein ZIC 1, Zinc finger protein 201, Zinc finger protein of the cerebellum 1) (MaxLight 750)
Sign In for Pricing
View Details MBS6365346-02 5x 0.1 mL
ZIC1, NT (ZIC1, ZIC, ZNF201, Zinc finger protein ZIC 1, Zinc finger protein 201, Zinc finger protein of the cerebellum 1) (MaxLight 750)
Sign In for Pricing
View Details