Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD12B Peptide - middle region

ABHD12B Peptide - middle region

Product Specifications

Product Name Alternative

BEM46L3, C14orf29, MGC129926, MGC129927, c14_5314

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABHD12B Rabbit Polyclonal Antibody (orb582058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_853511

Preservative

Lyophilized powder

AA Sequence

ARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal beta Tubulin Antibody (S11B) [DyLight 405]
NBP2-81064V 0.1 mL

Rabbit Monoclonal beta Tubulin Antibody (S11B) [DyLight 405]

Sign In for Pricing
View Details
KIF3A (NM_007054) Human Tagged ORF Clone Lentiviral Particle
RC221331L3V 200 µL

KIF3A (NM_007054) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C17orf81 Peptide - C-terminal region
MBS3236503-01 0.1 mg

C17orf81 Peptide - C-terminal region

Sign In for Pricing
View Details
C17orf81 Peptide - C-terminal region
MBS3236503-02 5x 0.1 mg

C17orf81 Peptide - C-terminal region

Sign In for Pricing
View Details
2-Amino-4- (pyridin-4-yl) -1,3-thiazole
260893-01 500 mg

2-Amino-4- (pyridin-4-yl) -1,3-thiazole

Sign In for Pricing
View Details
2-Amino-4- (pyridin-4-yl) -1,3-thiazole
260893-02 1 g

2-Amino-4- (pyridin-4-yl) -1,3-thiazole

Sign In for Pricing
View Details