Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACBD6 Peptide - middle region

ACBD6 Peptide - middle region

Product Specifications

Product Name Alternative

MGC2404

UniProt

Q9BR61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACBD6 Rabbit Polyclonal Antibody (orb584666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115736

Preservative

Lyophilized powder

AA Sequence

EAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTGFGGPVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf41 Antibody
MBS8604629-01 0.1 mg

C8orf41 Antibody

Sign In for Pricing
View Details
C8orf41 Antibody
MBS8604629-02 0.1 mL (AF405L)

C8orf41 Antibody

Sign In for Pricing
View Details
C8orf41 Antibody
MBS8604629-03 0.1 mL (AF405S)

C8orf41 Antibody

Sign In for Pricing
View Details
C8orf41 Antibody
MBS8604629-04 0.1 mL (AF610)

C8orf41 Antibody

Sign In for Pricing
View Details
C8orf41 Antibody
MBS8604629-05 0.1 mL (AF635)

C8orf41 Antibody

Sign In for Pricing
View Details
C8orf41 Antibody
MBS8604629-06 0.1 mL (APC)

C8orf41 Antibody

Sign In for Pricing
View Details