Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACBD6 Peptide - middle region

ACBD6 Peptide - middle region

Product Specifications

Product Name Alternative

MGC2404

UniProt

Q9BR61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACBD6 Rabbit Polyclonal Antibody (orb584666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115736

Preservative

Lyophilized powder

AA Sequence

EAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTGFGGPVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm15085 3'UTR Luciferase Stable Cell Line
TU107684 1.0 mL

Gm15085 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-IGF1 Receptor Antibody
MBS822023-01 0.03 mL

Anti-IGF1 Receptor Antibody

Sign In for Pricing
View Details
Anti-IGF1 Receptor Antibody
MBS822023-02 0.05 mL

Anti-IGF1 Receptor Antibody

Sign In for Pricing
View Details
Anti-IGF1 Receptor Antibody
MBS822023-03 0.1 mL

Anti-IGF1 Receptor Antibody

Sign In for Pricing
View Details
Anti-IGF1 Receptor Antibody
MBS822023-04 0.2 mL

Anti-IGF1 Receptor Antibody

Sign In for Pricing
View Details
Anti-IGF1 Receptor Antibody
MBS822023-05 5x 0.2 mL

Anti-IGF1 Receptor Antibody

Sign In for Pricing
View Details