Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTL8 Peptide - C-terminal region

ACTL8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CT57

UniProt

Q9H568

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTL8 Rabbit Polyclonal Antibody (orb585541) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110439

Preservative

Lyophilized powder

AA Sequence

DRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Stomach
CS624755 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Calindol Amide
TRC-C148650-50MG 50 mg

Calindol Amide

Sign In for Pricing
View Details
N-Butyl-N-(4-hydroxybutyl)nitrosamine
TRC-N281270-2.5G 2.5 g

N-Butyl-N-(4-hydroxybutyl)nitrosamine

Sign In for Pricing
View Details
ITIH4 (890-903) Goat Polyclonal Antibody
AP31103PU-N 100 µg

ITIH4 (890-903) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Spleen
CS808999 5x 5 µm

Tissue FFPE Sections, Spleen

Sign In for Pricing
View Details
DGKA (NM_001345) Human Over-expression Lysate
LY400535 100 µg

DGKA (NM_001345) Human Over-expression Lysate

Sign In for Pricing
View Details