Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTL8 Peptide - C-terminal region

ACTL8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CT57

UniProt

Q9H568

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTL8 Rabbit Polyclonal Antibody (orb585541) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110439

Preservative

Lyophilized powder

AA Sequence

DRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quercetin Hydrate
TRC-Q509703-5G 5 g

Quercetin Hydrate

Sign In for Pricing
View Details
6-Carboxyfluorescein-4',5'-bis(2,2,2-trifluoroacetato)-di Mercurate
TRC-C173665-50MG 50 mg

6-Carboxyfluorescein-4',5'-bis(2,2,2-trifluoroacetato)-di Mercurate

Sign In for Pricing
View Details
H3C14 Rabbit Polyclonal Antibody
TA397502 50 µg

H3C14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SIRT1 Recombinant Rabbit Monoclonal Antibody [SZ04-01]
ET1603-3 100 µL

SIRT1 Recombinant Rabbit Monoclonal Antibody [SZ04-01]

Sign In for Pricing
View Details
Ethyl Carbitol Acetate
TRC-E495975-25G 25 g

Ethyl Carbitol Acetate

Sign In for Pricing
View Details
DUSP14 (NM_007026) Human Over-expression Lysate
LY402077 100 µg

DUSP14 (NM_007026) Human Over-expression Lysate

Sign In for Pricing
View Details