Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAMTS19 Peptide - N-terminal region

ADAMTS19 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ16042

UniProt

Q8TE59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAMTS19 Rabbit Polyclonal Antibody (orb577296) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598377

Preservative

Lyophilized powder

AA Sequence

MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-500 1x 500 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-100 1x 100 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF640R conjugate, 0.1mg/mL
BNC401989-500 1x 500 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF405S conjugate, 0.1mg/mL
BNC042984-100 1x 100 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF568 conjugate, 0.1mg/mL
BNC682554-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details