Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGGF1 Peptide - middle region

AGGF1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ10283, GPATC7, GPATCH7, HSU84971, HUS84971, VG5Q

UniProt

Q8N302

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGGF1 Rabbit Polyclonal Antibody (orb583443) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060516

Preservative

Lyophilized powder

AA Sequence

EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR

More Discoveries

Explore Other Products

Browse additional items from our catalog

NABC1 Antibody
orb1821805 100 µL

NABC1 Antibody

Sign In for Pricing
View Details
FAS/TNFRSF6 Protein (C-His, Mouse)
P515078 100 µg

FAS/TNFRSF6 Protein (C-His, Mouse)

Sign In for Pricing
View Details
delta1-Adrenosterone
TRC-A305605-1G 1 g

delta1-Adrenosterone

Sign In for Pricing
View Details
Mouse Monoclonal Von Willebrand Factor Antibody (SPM577)
NBP2-33004-0.1mg 0.1 mg

Mouse Monoclonal Von Willebrand Factor Antibody (SPM577)

Sign In for Pricing
View Details
Alpha-1-acid glycoprotein 1
AP80098 1 mg

Alpha-1-acid glycoprotein 1

Sign In for Pricing
View Details
GENLISA™ Androsterone (ADT) ELISA
KLU0062 1x 96 Well

GENLISA™ Androsterone (ADT) ELISA

Sign In for Pricing
View Details