Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGGF1 Peptide - middle region

AGGF1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ10283, GPATC7, GPATCH7, HSU84971, HUS84971, VG5Q

UniProt

Q8N302

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AGGF1 Rabbit Polyclonal Antibody (orb583443) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060516

Preservative

Lyophilized powder

AA Sequence

EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR

More Discoveries

Explore Other Products

Browse additional items from our catalog

[4- (Prop-2-yn-1-yloxy) phenyl]methanamine
TMB02655-01 100 mg

[4- (Prop-2-yn-1-yloxy) phenyl]methanamine

Sign In for Pricing
View Details
[4- (Prop-2-yn-1-yloxy) phenyl]methanamine
TMB02655-02 1 g

[4- (Prop-2-yn-1-yloxy) phenyl]methanamine

Sign In for Pricing
View Details
Nt5dc2 siRNA Oligos set (Rat)
32229176 3x 5 nmol

Nt5dc2 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Ethyl Violet Azide Broth
RDM-EVAB-01 500 g

Ethyl Violet Azide Broth

Sign In for Pricing
View Details
Anti-Starlet sea anemone Nvop11 Antibody
DZ41709-carrier-free 200 µL/Vial

Anti-Starlet sea anemone Nvop11 Antibody

Sign In for Pricing
View Details
Mouse Serp2 Pre-designed siRNA Set B
SI112726B 1 Each

Mouse Serp2 Pre-designed siRNA Set B

Sign In for Pricing
View Details