Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ak3 Peptide - C-terminal region

Ak3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA407498, AI506714, AK-3, Ak3l, Ak3l1, Akl3l

UniProt

Q9WTP7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ak3 Rabbit Polyclonal Antibody (orb326130) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067274

Preservative

Lyophilized powder

AA Sequence

LTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospholipase A2 (PLB1) Rabbit Polyclonal Antibody
TA380011 100 µL

Phospholipase A2 (PLB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Porcine Von Willebrand Factor (vWF) ELISA Kit
RD-vWF-p-01 96 Tests

Porcine Von Willebrand Factor (vWF) ELISA Kit

Sign In for Pricing
View Details
Porcine Von Willebrand Factor (vWF) ELISA Kit
RD-vWF-p-02 48 Tests

Porcine Von Willebrand Factor (vWF) ELISA Kit

Sign In for Pricing
View Details
SIGLEC11 Human Gene Knockout Kit (CRISPR)
KN417861 1 Kit

SIGLEC11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AccuBlue® High Sensitivity dsDNA Quantitation Kit with DNA Standard, trial size (200 assays)
#31006-T 1 Kit

AccuBlue® High Sensitivity dsDNA Quantitation Kit with DNA Standard, trial size (200 assays)

Sign In for Pricing
View Details
Tissue FFPE Sections, Renal pelvis
CS706045 5x 5 µm

Tissue FFPE Sections, Renal pelvis

Sign In for Pricing
View Details